![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) |
![]() | Domain d2f4vc1: 2f4v C:2-106 [132938] Other proteins in same PDB: d2f4vb1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1 automatically matched to d1fjgc1 complexed with ab9, d2c, k, mg, zn |
PDB Entry: 2f4v (more details), 3.8 Å
SCOP Domain Sequences for d2f4vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4vc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d2f4vc1: