SCOPe 2.01: Domain d2f4ob_: 2f4o B:

Lineage for d2f4ob_ (2f4o B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.189: XPC-binding domain [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (1 family)

5. Family a.189.1.1: XPC-binding domain [101239] (4 proteins)

6. Protein automated matches [190283] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187083] (2 PDB entries)

8. Domain d2f4ob_: 2f4o B: [132932]
   Other proteins in same PDB: d2f4oa_
   automated match to d1pvea_
   complexed with cl, zn

Details for d2f4ob_

PDB Entry: 2f4o, 2.26 Å

PDB Description: the mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs

PDB Compounds: (B:) XP-C repair complementing complex 58 kDa protein

SCOPe Domain Sequences for d2f4ob_:

Sequence; same for both SEQRES and ATOM records:

>d2f4ob_ a.189.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
g

Timeline for d2f4ob_:

• d2f4ob_ first appeared in SCOP 1.73, called d2f4ob1
  
• d2f4ob_ was called d2f4ob1 in SCOP 1.75
  
• d2f4ob_ appears in SCOPe 2.02
  
• d2f4ob_ appears in the current release, SCOPe 2.08, called d2f4ob2