Lineage for d2f44c1 (2f44 C:2-63)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770859Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 770915Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)
  7. 770916Species Rat(Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)
    Uniprot Q9JLU4 1749-1815
  8. 770922Domain d2f44c1: 2f44 C:2-63 [132913]
    automatically matched to 2F3N A:2-65
    complexed with cl, zn; mutant

Details for d2f44c1

PDB Entry: 2f44 (more details), 2.4 Å

PDB Description: Crystal Structure of the Zinc-bound Shank SAM domain
PDB Compounds: (C:) SH3 and multiple ankyrin repeat domains 3

SCOP Domain Sequences for d2f44c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f44c1 a.60.1.2 (C:2-63) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lr

SCOP Domain Coordinates for d2f44c1:

Click to download the PDB-style file with coordinates for d2f44c1.
(The format of our PDB-style files is described here.)

Timeline for d2f44c1: