SCOP 1.73: Domain d2f44c1: 2f44 C:2-63

Lineage for d2f44c1 (2f44 C:2-63)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)

7. Species Rat(Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)

8. Domain d2f44c1: 2f44 C:2-63 [132913]
   automatically matched to 2F3N A:2-65
   complexed with cl, zn; mutant

Details for d2f44c1

PDB Entry: 2f44, 2.4 Å

PDB Description: crystal structure of the zinc-bound shank sam domain

PDB Compounds: (C:) SH3 and multiple ankyrin repeat domains 3

SCOP Domain Sequences for d2f44c1:

Sequence; same for both SEQRES and ATOM records:

>d2f44c1 a.60.1.2 (C:2-63) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lr

Timeline for d2f44c1:

• d2f44c1 is new in SCOP 1.73
  
• d2f44c1 appears in SCOP 1.75
  
• d2f44c1 appears in the current release, SCOPe 2.08, called d2f44c_