SCOP 1.73: Domain d2f3hb1: 2f3h B:11-335

Lineage for d2f3hb1 (2f3h B:11-335)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)

6. Protein Fructose-1,6-bisphosphatase [56657] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56658] (49 PDB entries)

8. Domain d2f3hb1: 2f3h B:11-335 [132871]
   automatically matched to d1cnqa_
   complexed with amp, f6p, mg, po4; mutant

Details for d2f3hb1

PDB Entry: 2f3h, 2.7 Å

PDB Description: Mechanism of displacement of a catalytically essential loop from the active site of fructose-1,6-bisphosphatase

PDB Compounds: (B:) Fructose-1,6-bisphosphatase 1

SCOP Domain Sequences for d2f3hb1:

Sequence; same for both SEQRES and ATOM records:

>d2f3hb1 e.7.1.1 (B:11-335) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
vtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdqv
kkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidclv
sigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpai
gefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmva
dvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdi
hqrapiilgspedvtelleiyqkha

Timeline for d2f3hb1:

• d2f3hb1 is new in SCOP 1.73
  
• d2f3hb1 appears in SCOP 1.75
  
• d2f3hb1 last appears in SCOPe 2.02, called d2f3hb_