SCOP 1.75: Domain d2f34a1: 2f34 A:5-116,A:119-252

Lineage for d2f34a1 (2f34 A:5-116,A:119-252)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)
   Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815

8. Domain d2f34a1: 2f34 A:5-116,A:119-252 [132852]
   automatically matched to 1TXF A:5-116,A:119-252
   complexed with 1pe, cl, uba; mutant

Details for d2f34a1

PDB Entry: 2f34, 1.74 Å

PDB Description: crystal structure of the glur5 ligand binding core dimer with ubp310 at 1.74 angstroms resolution

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOP Domain Sequences for d2f34a1:

Sequence; same for both SEQRES and ATOM records:

>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkXpidsadd
lakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttdy
allmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhm
mkekwwr

Timeline for d2f34a1:

• d2f34a1 first appeared in SCOP 1.73
  
• d2f34a1 does not appear in SCOPe 2.01