| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins) Pfam PF01055 |
| Protein Putative glucosidase YicI, domain 2 [117373] (1 species) |
| Species Escherichia coli [TaxId:562] [117374] (5 PDB entries) Uniprot P31434 |
| Domain d2f2hd4: 2f2h D:248-585 [132833] Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha3, d2f2ha5, d2f2hb1, d2f2hb2, d2f2hb3, d2f2hb5, d2f2hc1, d2f2hc2, d2f2hc3, d2f2hc5, d2f2hd1, d2f2hd2, d2f2hd3, d2f2hd5, d2f2he1, d2f2he2, d2f2he3, d2f2he5, d2f2hf1, d2f2hf2, d2f2hf3, d2f2hf5 automated match to d2f2ha4 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2hd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hd4 c.1.8.13 (D:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt
Timeline for d2f2hd4:
View in 3DDomains from same chain: (mouse over for more information) d2f2hd1, d2f2hd2, d2f2hd3, d2f2hd5 |