Lineage for d2f2ha4 (2f2h A:248-585)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683562Family c.1.8.13: YicI catalytic domain-like [117372] (2 proteins)
  6. 683566Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 683567Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
  8. 683568Domain d2f2ha4: 2f2h A:248-585 [132821]
    Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha3, d2f2hb1, d2f2hb2, d2f2hb3, d2f2hc1, d2f2hc2, d2f2hc3, d2f2hd1, d2f2hd2, d2f2hd3, d2f2he1, d2f2he2, d2f2he3, d2f2hf1, d2f2hf2, d2f2hf3
    complexed with gol, mpo, so4, xtg

Details for d2f2ha4

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (A:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2ha4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOP Domain Coordinates for d2f2ha4:

Click to download the PDB-style file with coordinates for d2f2ha4.
(The format of our PDB-style files is described here.)

Timeline for d2f2ha4: