Lineage for d2f2ha3 (2f2h A:586-665)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077411Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)
  6. 2077425Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 2077426Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 2077427Domain d2f2ha3: 2f2h A:586-665 [132820]
    Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha4, d2f2ha5, d2f2hb1, d2f2hb2, d2f2hb4, d2f2hb5, d2f2hc1, d2f2hc2, d2f2hc4, d2f2hc5, d2f2hd1, d2f2hd2, d2f2hd4, d2f2hd5, d2f2he1, d2f2he2, d2f2he4, d2f2he5, d2f2hf1, d2f2hf2, d2f2hf4, d2f2hf5
    complexed with gol, mpo, so4, xtg

Details for d2f2ha3

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (A:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d2f2ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ha3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d2f2ha3:

Click to download the PDB-style file with coordinates for d2f2ha3.
(The format of our PDB-style files is described here.)

Timeline for d2f2ha3: