Lineage for d2f1dp1 (2f1d P:10-95)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176939Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2176962Protein automated matches [254526] (1 species)
    not a true protein
  7. 2176963Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (10 PDB entries)
  8. 2177008Domain d2f1dp1: 2f1d P:10-95 [132758]
    Other proteins in same PDB: d2f1da1, d2f1da2
    automated match to d2f1da1
    complexed with mn, so4

Details for d2f1dp1

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (P:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1dp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1dp1 d.14.1.9 (P:10-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
iddhhtnedialaigtallkalgerk

SCOPe Domain Coordinates for d2f1dp1:

Click to download the PDB-style file with coordinates for d2f1dp1.
(The format of our PDB-style files is described here.)

Timeline for d2f1dp1: