Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein) duplication; there are two structural repeats of this fold |
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry) Uniprot P34047 159-255! Uniprot P34047 73-158 |
Domain d2f1dk2: 2f1d K:96-192 [132749] automatically matched to 2F1D A:96-192 complexed with mn, so4 |
PDB Entry: 2f1d (more details), 3 Å
SCOPe Domain Sequences for d2f1dk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1dk2 d.14.1.9 (K:96-192) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg mtlhirqlagenshhiieatfkafaralrqatetdpr
Timeline for d2f1dk2:
View in 3D Domains from other chains: (mouse over for more information) d2f1da1, d2f1da2, d2f1db1, d2f1db2, d2f1dc1, d2f1dc2, d2f1dd1, d2f1dd2, d2f1de1, d2f1de2, d2f1df1, d2f1df2, d2f1dg1, d2f1dg2, d2f1dh1, d2f1dh2, d2f1di1, d2f1di2, d2f1dj1, d2f1dj2, d2f1dl1, d2f1dl2, d2f1dm1, d2f1dm2, d2f1dn1, d2f1dn2, d2f1do1, d2f1do2, d2f1dp1, d2f1dp2 |