SCOPe 2.03: Domain d2f1di2: 2f1d I:96-192

Lineage for d2f1di2 (2f1d I:96-192)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
   duplication; there are two structural repeats of this fold

6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
   Uniprot P34047 159-255! Uniprot P34047 73-158

8. Domain d2f1di2: 2f1d I:96-192 [132745]
   automatically matched to 2F1D A:96-192
   complexed with mn, so4

Details for d2f1di2

PDB Entry: 2f1d, 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase

PDB Compounds: (I:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1di2:

Sequence; same for both SEQRES and ATOM records:

>d2f1di2 d.14.1.9 (I:96-192) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagenshhiieatfkafaralrqatetdpr

Timeline for d2f1di2:

• d2f1di2 first appeared in SCOP 1.73
  
• d2f1di2 appears in SCOPe 2.02
  
• d2f1di2 appears in SCOPe 2.04
  
• d2f1di2 appears in the current release, SCOPe 2.08