Lineage for d2f16z_ (2f16 Z:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045451Domain d2f16z_: 2f16 Z: [132716]
    Other proteins in same PDB: d2f16a_, d2f16b_, d2f16c_, d2f16d1, d2f16e_, d2f16f_, d2f16g_, d2f16o_, d2f16p_, d2f16q_, d2f16r1, d2f16s_, d2f16t_, d2f16u_
    automated match to d1g0ul_
    complexed with bo2

Details for d2f16z_

PDB Entry: 2f16 (more details), 2.8 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with bortezomib
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d2f16z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f16z_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d2f16z_:

Click to download the PDB-style file with coordinates for d2f16z_.
(The format of our PDB-style files is described here.)

Timeline for d2f16z_: