SCOPe 2.05: Domain d2f16w_: 2f16 W:

Lineage for d2f16w_ (2f16 W:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2f16w_: 2f16 W: [132713]
   Other proteins in same PDB: d2f16a_, d2f16b_, d2f16c_, d2f16e_, d2f16f_, d2f16g_, d2f16o_, d2f16p_, d2f16q_, d2f16s_, d2f16t_, d2f16u_
   automated match to d1g0ui_
   complexed with bo2

Details for d2f16w_

PDB Entry: 2f16, 2.8 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with bortezomib

PDB Compounds: (W:) Proteasome component PUP3

SCOPe Domain Sequences for d2f16w_:

Sequence; same for both SEQRES and ATOM records:

>d2f16w_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d2f16w_:

• d2f16w_ first appeared in SCOP 1.73, called d2f16w1
  
• d2f16w_ appears in SCOPe 2.04
  
• d2f16w_ appears in SCOPe 2.06
  
• d2f16w_ appears in the current release, SCOPe 2.08