Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d2f16g_: 2f16 G: [132697] Other proteins in same PDB: d2f161_, d2f162_, d2f16a_, d2f16b_, d2f16c_, d2f16d_, d2f16e_, d2f16f_, d2f16h_, d2f16i_, d2f16j_, d2f16k_, d2f16l_, d2f16m_, d2f16n_, d2f16o_, d2f16p_, d2f16q_, d2f16r_, d2f16s_, d2f16t_, d2f16v_, d2f16w_, d2f16x_, d2f16y_, d2f16z_ automated match to d1g65g_ complexed with bo2 |
PDB Entry: 2f16 (more details), 2.8 Å
SCOPe Domain Sequences for d2f16g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f16g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d2f16g_:
View in 3D Domains from other chains: (mouse over for more information) d2f161_, d2f162_, d2f16a_, d2f16b_, d2f16c_, d2f16d_, d2f16e_, d2f16f_, d2f16h_, d2f16i_, d2f16j_, d2f16k_, d2f16l_, d2f16m_, d2f16n_, d2f16o_, d2f16p_, d2f16q_, d2f16r_, d2f16s_, d2f16t_, d2f16u_, d2f16v_, d2f16w_, d2f16x_, d2f16y_, d2f16z_ |