Lineage for d2f0za1 (2f0z A:3-377)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 675050Protein Sialidase 2 (Neu2) [117274] (1 species)
  7. 675051Species Human (Homo sapiens) [TaxId:9606] [117275] (8 PDB entries)
  8. 675057Domain d2f0za1: 2f0z A:3-377 [132683]
    automatically matched to d1vcua_
    complexed with zmr

Details for d2f0za1

PDB Entry: 2f0z (more details), 2.8 Å

PDB Description: Crystal Structure of the Human Sialidase Neu2 in Complex with Zanamivir inhibitor
PDB Compounds: (A:) Sialidase 2

SCOP Domain Sequences for d2f0za1:

Sequence, based on SEQRES records: (download)

>d2f0za1 b.68.1.1 (A:3-377) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdydap
thqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvt
rlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayr
klhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlra
rvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthsw
qradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeei
vflmftlkqafpaey

Sequence, based on observed residues (ATOM records): (download)

>d2f0za1 b.68.1.1 (A:3-377) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraelivlrrgdydapthqvqwq
aqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvtrlcqvts
tdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklrpips
afcflshdhgrtwarghfvaqdtlecqvaeveqrvvtlnarshlrarvqaqstndgldfq
esqlvkklvepppqgcqgsvisfpsprpaqwllythpthswqradlgaylnprppapeaw
sepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey

SCOP Domain Coordinates for d2f0za1:

Click to download the PDB-style file with coordinates for d2f0za1.
(The format of our PDB-style files is described here.)

Timeline for d2f0za1: