Lineage for d2f0xb1 (2f0x B:3-138)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858831Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)
  6. 858877Protein Hypothetical protein Them2 [143179] (2 species)
  7. 858878Species Human (Homo sapiens) [TaxId:9606] [143181] (2 PDB entries)
    Uniprot Q9NPJ3 19-139! Uniprot Q9NPJ3 3-138
  8. 858880Domain d2f0xb1: 2f0x B:3-138 [132674]
    automatically matched to 2F0X A:3-138
    complexed with so4

Details for d2f0xb1

PDB Entry: 2f0x (more details), 2.3 Å

PDB Description: crystal structure and function of human thioesterase superfamily member 2(them2)
PDB Compounds: (B:) Thioesterase superfamily member 2

SCOP Domain Sequences for d2f0xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0xb1 d.38.1.5 (B:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]}
smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
katgkliaqgrhtkhl

SCOP Domain Coordinates for d2f0xb1:

Click to download the PDB-style file with coordinates for d2f0xb1.
(The format of our PDB-style files is described here.)

Timeline for d2f0xb1: