Class b: All beta proteins [48724] (177 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
Protein Baseplate protein (bpp), C-terminal domain [141123] (1 species) |
Species Lactococcus phage tp901-1 [TaxId:35345] [141124] (1 PDB entry) Uniprot Q9G096 63-163 |
Domain d2f0ca1: 2f0c A:63-163 [132665] Other proteins in same PDB: d2f0ca2, d2f0cb2, d2f0cc2 complexed with gol |
PDB Entry: 2f0c (more details), 1.65 Å
SCOPe Domain Sequences for d2f0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0ca1 b.21.1.3 (A:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]} ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d2f0ca1:
View in 3D Domains from other chains: (mouse over for more information) d2f0cb1, d2f0cb2, d2f0cc1, d2f0cc2 |