![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.7: ML domain [81287] (3 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products automatically mapped to Pfam PF02221 |
![]() | Protein Major mite allergen [49256] (2 species) contains additional N-terminal strand |
![]() | Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries) Uniprot Q00855 18-146 |
![]() | Domain d2f08b_: 2f08 B: [132657] automated match to d1ahk__ complexed with p4c |
PDB Entry: 2f08 (more details), 2.2 Å
SCOPe Domain Sequences for d2f08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f08b_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]} dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca iathgkird
Timeline for d2f08b_: