Lineage for d2eztb2 (2ezt B:9-182)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361464Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1361590Protein Pyruvate oxidase [88729] (2 species)
  7. 1361596Species Lactobacillus plantarum [TaxId:1590] [88730] (7 PDB entries)
  8. 1361608Domain d2eztb2: 2ezt B:9-182 [132637]
    Other proteins in same PDB: d2ezta1, d2ezta3, d2eztb1, d2eztb3
    automatically matched to d1powa2
    complexed with fad, mg, na, po4, pyr, tdm

Details for d2eztb2

PDB Entry: 2ezt (more details), 2.29 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate
PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d2eztb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eztb2 c.36.1.5 (B:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

SCOPe Domain Coordinates for d2eztb2:

Click to download the PDB-style file with coordinates for d2eztb2.
(The format of our PDB-style files is described here.)

Timeline for d2eztb2: