SCOPe 2.06: Domain d2eywa2: 2eyw A:125-198

Lineage for d2eywa2 (2eyw A:125-198)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)

8. Domain d2eywa2: 2eyw A:125-198 [132603]
   Other proteins in same PDB: d2eywa3
   automated match to d1pwta_

Details for d2eywa2

PDB Entry: 2eyw

PDB Description: n-terminal sh3 domain of ct10-regulated kinase

PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOPe Domain Sequences for d2eywa2:

Sequence; same for both SEQRES and ATOM records:

>d2eywa2 b.34.2.0 (A:125-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgvilrqeeaeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipv
pyvekyrpasasvs

Timeline for d2eywa2:

• d2eywa2 first appeared in SCOP 1.73, called d2eywa1
  
• d2eywa2 was called d2eywa_ in SCOPe 2.05
  
• d2eywa2 appears in SCOPe 2.07
  
• d2eywa2 appears in the current release, SCOPe 2.08