Lineage for d2ey4a1 (2ey4 A:253-336)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966930Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 966931Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 966932Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 966955Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 966965Species Pyrococcus furiosus [TaxId:2261] [141699] (3 PDB entries)
    Uniprot Q7LWY0 250-333
  8. 966966Domain d2ey4a1: 2ey4 A:253-336 [132578]
    Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_
    complexed with zn

Details for d2ey4a1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2ey4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4a1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

SCOPe Domain Coordinates for d2ey4a1:

Click to download the PDB-style file with coordinates for d2ey4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4a1: