Lineage for d2exyf1 (2exy F:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035526Domain d2exyf1: 2exy F:1-106 [132576]
    Other proteins in same PDB: d2exya_, d2exyb_, d2exyd2, d2exyf2
    automated match to d1ikfl1
    mutant

Details for d2exyf1

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: crystal structure of the e148q mutant of ecclc, fab complexed in absence of bound ions
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d2exyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exyf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d2exyf1:

Click to download the PDB-style file with coordinates for d2exyf1.
(The format of our PDB-style files is described here.)

Timeline for d2exyf1: