Lineage for d2exyf1 (2exy F:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653446Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
  8. 653508Domain d2exyf1: 2exy F:1-105 [132576]
    Other proteins in same PDB: d2exya1, d2exyb1, d2exyd2, d2exyf2
    automatically matched to d1dqdl1
    mutant

Details for d2exyf1

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOP Domain Sequences for d2exyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exyf1 b.1.1.1 (F:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOP Domain Coordinates for d2exyf1:

Click to download the PDB-style file with coordinates for d2exyf1.
(The format of our PDB-style files is described here.)

Timeline for d2exyf1: