Lineage for d2exyb1 (2exy B:18-458)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745392Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 745393Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 745394Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 745395Protein Clc chloride channel [69913] (2 species)
  7. 745396Species Escherichia coli [TaxId:562] [69914] (9 PDB entries)
  8. 745416Domain d2exyb1: 2exy B:18-458 [132573]
    Other proteins in same PDB: d2exyd1, d2exyd2, d2exyf1, d2exyf2
    automatically matched to d1otua_
    mutant

Details for d2exyb1

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOP Domain Sequences for d2exyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exyb1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOP Domain Coordinates for d2exyb1:

Click to download the PDB-style file with coordinates for d2exyb1.
(The format of our PDB-style files is described here.)

Timeline for d2exyb1: