![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d2exwf2: 2exw F:107-210 [132571] Other proteins in same PDB: d2exwa1, d2exwb1, d2exwd1, d2exwf1 automatically matched to d1dqdl2 |
PDB Entry: 2exw (more details), 3.2 Å
SCOP Domain Sequences for d2exwf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exwf2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2exwf2:
![]() Domains from other chains: (mouse over for more information) d2exwa1, d2exwb1, d2exwd1, d2exwd2 |