Lineage for d2exwf1 (2exw F:1-105)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783142Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 783184Domain d2exwf1: 2exw F:1-105 [132570]
    Other proteins in same PDB: d2exwa1, d2exwb1, d2exwd2, d2exwf2
    automatically matched to d1dqdl1

Details for d2exwf1

PDB Entry: 2exw (more details), 3.2 Å

PDB Description: Crystal structure of a EcClC-Fab complex in the absence of bound ions
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOP Domain Sequences for d2exwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exwf1 b.1.1.1 (F:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOP Domain Coordinates for d2exwf1:

Click to download the PDB-style file with coordinates for d2exwf1.
(The format of our PDB-style files is described here.)

Timeline for d2exwf1: