SCOPe 2.01: Domain d2exwa1: 2exw A:17-460

Lineage for d2exwa1 (2exw A:17-460)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (1 protein)
   duplication: consist of two similar structural parts

6. Protein Clc chloride channel [69913] (2 species)

7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)

8. Domain d2exwa1: 2exw A:17-460 [132566]
   Other proteins in same PDB: d2exwd1, d2exwd2, d2exwf1, d2exwf2
   automatically matched to d1kpka_

Details for d2exwa1

PDB Entry: 2exw, 3.2 Å

PDB Description: Crystal structure of a EcClC-Fab complex in the absence of bound ions

PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2exwa1:

Sequence; same for both SEQRES and ATOM records:

>d2exwa1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

Timeline for d2exwa1:

• d2exwa1 first appeared in SCOP 1.73
  
• d2exwa1 appears in SCOP 1.75
  
• d2exwa1 appears in SCOPe 2.02
  
• d2exwa1 appears in the current release, SCOPe 2.08