Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Azoarcus sp. [TaxId:76114] [187073] (1 PDB entry) |
Domain d2ew8d_: 2ew8 D: [132450] Other proteins in same PDB: d2ew8a1 automated match to d1i01a_ complexed with so4 |
PDB Entry: 2ew8 (more details), 2.1 Å
SCOPe Domain Sequences for d2ew8d_:
Sequence, based on SEQRES records: (download)
>d2ew8d_ c.2.1.0 (D:) automated matches {Azoarcus sp. [TaxId: 76114]} qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav dggmvrh
>d2ew8d_ c.2.1.0 (D:) automated matches {Azoarcus sp. [TaxId: 76114]} qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai apslvnmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
Timeline for d2ew8d_: