Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab30 [142239] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142240] (1 PDB entry) Uniprot Q15771 5-175 |
Domain d2ew1a1: 2ew1 A:4-174 [132446] complexed with gnp, mg |
PDB Entry: 2ew1 (more details), 2 Å
SCOPe Domain Sequences for d2ew1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} dydflfkivlignagvgktclvrrftqglfppgqgatigvdfmiktveingekvklqiwd tagqerfrsitqsyyrsanaliltyditceesfrclpewlreieqyasnkvitvlvgnki dlaerrevsqqraeefseaqdmyyletsakesdnveklfldlacrlisear
Timeline for d2ew1a1: