Lineage for d2ew1a1 (2ew1 A:4-174)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124808Protein Rab30 [142239] (1 species)
  7. 2124809Species Human (Homo sapiens) [TaxId:9606] [142240] (1 PDB entry)
    Uniprot Q15771 5-175
  8. 2124810Domain d2ew1a1: 2ew1 A:4-174 [132446]
    complexed with gnp, mg

Details for d2ew1a1

PDB Entry: 2ew1 (more details), 2 Å

PDB Description: Crystal Structure of Rab30 in complex with a GTP analogue
PDB Compounds: (A:) Ras-related protein Rab-30

SCOPe Domain Sequences for d2ew1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}
dydflfkivlignagvgktclvrrftqglfppgqgatigvdfmiktveingekvklqiwd
tagqerfrsitqsyyrsanaliltyditceesfrclpewlreieqyasnkvitvlvgnki
dlaerrevsqqraeefseaqdmyyletsakesdnveklfldlacrlisear

SCOPe Domain Coordinates for d2ew1a1:

Click to download the PDB-style file with coordinates for d2ew1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ew1a1: