Lineage for d2euta_ (2eut A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919428Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 919429Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (131 PDB entries)
    Uniprot P00431
  8. 919431Domain d2euta_: 2eut A: [132407]
    automated match to d1aa4__
    complexed with bvf, hem

Details for d2euta_

PDB Entry: 2eut (more details), 1.12 Å

PDB Description: cytochrome c peroxidase (ccp) in complex with 2-amino-4-picoline
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d2euta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euta_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2euta_:

Click to download the PDB-style file with coordinates for d2euta_.
(The format of our PDB-style files is described here.)

Timeline for d2euta_: