Lineage for d2eufb1 (2euf B:10-305)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434513Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434514Species Human (Homo sapiens) [TaxId:9606] [88860] (11 PDB entries)
  8. 1434522Domain d2eufb1: 2euf B:10-305 [132386]
    Other proteins in same PDB: d2eufa1, d2eufa2
    automatically matched to d1blxa_
    complexed with act, ca, dms, lqq

Details for d2eufb1

PDB Entry: 2euf (more details), 3 Å

PDB Description: X-ray structure of human CDK6-Vcyclin in complex with the inhibitor PD0332991
PDB Compounds: (B:) cell division protein kinase 6

SCOPe Domain Sequences for d2eufb1:

Sequence, based on SEQRES records: (download)

>d2eufb1 d.144.1.7 (B:10-305) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhle
tfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfql
lrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrape
vllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdval
prqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

Sequence, based on observed residues (ATOM records): (download)

>d2eufb1 d.144.1.7 (B:10-305) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhle
tfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfql
lrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrape
vllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpaqpie
kfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

SCOPe Domain Coordinates for d2eufb1:

Click to download the PDB-style file with coordinates for d2eufb1.
(The format of our PDB-style files is described here.)

Timeline for d2eufb1: