Lineage for d2eufb_ (2euf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981002Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2981003Species Human (Homo sapiens) [TaxId:9606] [88860] (16 PDB entries)
  8. 2981008Domain d2eufb_: 2euf B: [132386]
    Other proteins in same PDB: d2eufa1, d2eufa2
    automated match to d1blxa_
    complexed with act, ca, dms, lqq

Details for d2eufb_

PDB Entry: 2euf (more details), 3 Å

PDB Description: X-ray structure of human CDK6-Vcyclin in complex with the inhibitor PD0332991
PDB Compounds: (B:) cell division protein kinase 6

SCOPe Domain Sequences for d2eufb_:

Sequence, based on SEQRES records: (download)

>d2eufb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhle
tfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfql
lrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrape
vllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdval
prqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

Sequence, based on observed residues (ATOM records): (download)

>d2eufb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhle
tfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfql
lrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrape
vllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpaqpie
kfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

SCOPe Domain Coordinates for d2eufb_:

Click to download the PDB-style file with coordinates for d2eufb_.
(The format of our PDB-style files is described here.)

Timeline for d2eufb_: