SCOP 1.75: Domain d2eucb1: 2euc B:1-113

Lineage for d2eucb1 (2euc B:1-113)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.249: YfmB-like [140687] (1 superfamily)
   5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain ((81593))
   5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain ((81593))

4. Superfamily a.249.1: YfmB-like [140688] (1 family)

5. Family a.249.1.1: YfmB-like [140689] (1 protein)

6. Protein Hypothetical protein YfmB [140690] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry)
   Uniprot O34626 1-113

8. Domain d2eucb1: 2euc B:1-113 [132383]
   automatically matched to 2EUC A:1-113

Details for d2eucb1

PDB Entry: 2euc, 2.5 Å

PDB Description: crystal structure of yfmb from bacillus subtilis. nesg target sr324

PDB Compounds: (B:) Hypothetical protein yfmB

SCOP Domain Sequences for d2eucb1:

Sequence, based on SEQRES records:

>d2eucb1 a.249.1.1 (B:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv

Sequence, based on observed residues (ATOM records):

>d2eucb1 a.249.1.1 (B:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv

Timeline for d2eucb1:

• d2eucb1 first appeared in SCOP 1.73
  
• d2eucb1 is called d2eucb_ in SCOPe 2.01
  
• d2eucb1 appears in the current release, SCOPe 2.08, called d2eucb_