![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
![]() | Domain d2esva2: 2esv A:2-181 [132349] Other proteins in same PDB: d2esva1, d2esvb2, d2esvb3, d2esvd1, d2esvd2, d2esve1, d2esve2 automatically matched to d1mhea2 complexed with iod |
PDB Entry: 2esv (more details), 2.6 Å
SCOPe Domain Sequences for d2esva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esva2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d2esva2: