Lineage for d2esva1 (2esv A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654678Domain d2esva1: 2esv A:182-274 [132348]
    Other proteins in same PDB: d2esva2, d2esvb1
    automatically matched to d1mhea1
    complexed with iod

Details for d2esva1

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOP Domain Sequences for d2esva1:

Sequence, based on SEQRES records: (download)

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

Sequence, based on observed residues (ATOM records): (download)

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdtelvetrpagdgtfqkwaavv
vpsgeeqrytchvqheglpepvtlrw

SCOP Domain Coordinates for d2esva1:

Click to download the PDB-style file with coordinates for d2esva1.
(The format of our PDB-style files is described here.)

Timeline for d2esva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2esva2
View in 3D
Domains from other chains:
(mouse over for more information)
d2esvb1