SCOPe 2.06: Domain d2espa1: 2esp A:1-147

Lineage for d2espa1 (2esp A:1-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (18 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d2espa1: 2esp A:1-147 [132342]
   Other proteins in same PDB: d2espa2
   complexed with cl, mpd; mutant

Details for d2espa1

PDB Entry: 2esp, 1.52 Å

PDB Description: human ubiquitin-conjugating enzyme (e2) ubch5b mutant ile88ala

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d2espa1:

Sequence; same for both SEQRES and ATOM records:

>d2espa1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldalrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d2espa1:

• d2espa1 first appeared in SCOP 1.73
  
• d2espa1 appears in SCOPe 2.05
  
• d2espa1 appears in SCOPe 2.07
  
• d2espa1 appears in the current release, SCOPe 2.08