Lineage for d2espa1 (2esp A:1-147)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857033Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 857041Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)
  7. 857127Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (8 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 857131Domain d2espa1: 2esp A:1-147 [132342]
    complexed with cl, mpd; mutant

Details for d2espa1

PDB Entry: 2esp (more details), 1.52 Å

PDB Description: human ubiquitin-conjugating enzyme (e2) ubch5b mutant ile88ala
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOP Domain Sequences for d2espa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2espa1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldalrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOP Domain Coordinates for d2espa1:

Click to download the PDB-style file with coordinates for d2espa1.
(The format of our PDB-style files is described here.)

Timeline for d2espa1: