SCOPe 2.08: Domain d2eslb_: 2esl B:

Lineage for d2eslb_ (2esl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
   Uniprot P45877 32-212

8. Domain d2eslb_: 2esl B: [132328]
   automated match to d2rmca_
   complexed with ca, so4, zn

Details for d2eslb_

PDB Entry: 2esl, 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2eslb_:

Sequence; same for both SEQRES and ATOM records:

>d2eslb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

Timeline for d2eslb_:

• d2eslb_ first appeared in SCOP 1.73, called d2eslb1
  
• d2eslb_ appears in SCOPe 2.07