Lineage for d2eqba_ (2eqb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 1595380Domain d2eqba_: 2eqb A: [132286]
    Other proteins in same PDB: d2eqbb1, d2eqbc_
    automated match to d1g16b_
    complexed with po4

Details for d2eqba_

PDB Entry: 2eqb (more details), 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex
PDB Compounds: (A:) Ras-related protein SEC4

SCOPe Domain Sequences for d2eqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqba_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gssimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdt
agqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksd
metrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn

SCOPe Domain Coordinates for d2eqba_:

Click to download the PDB-style file with coordinates for d2eqba_.
(The format of our PDB-style files is described here.)

Timeline for d2eqba_: