SCOPe 2.01: Domain d2eqba_: 2eqb A:

Lineage for d2eqba_ (2eqb A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (2 PDB entries)

8. Domain d2eqba_: 2eqb A: [132286]
   Other proteins in same PDB: d2eqbb1, d2eqbc1
   automated match to d1g16b_
   complexed with po4

Details for d2eqba_

PDB Entry: 2eqb, 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex

PDB Compounds: (A:) Ras-related protein SEC4

SCOPe Domain Sequences for d2eqba_:

Sequence; same for both SEQRES and ATOM records:

>d2eqba_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gssimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdt
agqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksd
metrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn

Timeline for d2eqba_:

• d2eqba_ first appeared in SCOP 1.73, called d2eqba1
  
• d2eqba_ was called d2eqba1 in SCOP 1.75
  
• d2eqba_ appears in SCOPe 2.02
  
• d2eqba_ appears in the current release, SCOPe 2.08, called d2eqba2