Lineage for d2eqba1 (2eqb A:19-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696051Protein Rab-related protein Sec4 [52607] (1 species)
  7. 696052Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (4 PDB entries)
  8. 696059Domain d2eqba1: 2eqb A:19-186 [132286]
    automatically matched to 2OCY C:18-186
    complexed with po4

Details for d2eqba1

PDB Entry: 2eqb (more details), 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex
PDB Compounds: (A:) Ras-related protein SEC4

SCOP Domain Sequences for d2eqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqba1 c.37.1.8 (A:19-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag
qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

SCOP Domain Coordinates for d2eqba1:

Click to download the PDB-style file with coordinates for d2eqba1.
(The format of our PDB-style files is described here.)

Timeline for d2eqba1: