Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab-related protein Sec4 [52607] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (4 PDB entries) |
Domain d2eqba1: 2eqb A:19-186 [132286] automatically matched to 2OCY C:18-186 complexed with po4 |
PDB Entry: 2eqb (more details), 2.7 Å
SCOP Domain Sequences for d2eqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eqba1 c.37.1.8 (A:19-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme trvvtadqgealakelgipfiessaknddnvneifftlakliqekids
Timeline for d2eqba1: