| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein automated matches [190273] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187065] (16 PDB entries) |
| Domain d2einz_: 2ein Z: [132278] Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_ automated match to d1occm_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOPe Domain Sequences for d2einz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d2einz_:
View in 3DDomains from other chains: (mouse over for more information) d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_ |