| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) ![]() |
| Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein) |
| Protein Cytochrome c oxidase subunit h [47696] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries) |
| Domain d2einu1: 2ein U:7-85 [132273] Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 automatically matched to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOP Domain Sequences for d2einu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einu1 a.51.1.1 (U:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki
Timeline for d2einu1:
View in 3DDomains from other chains: (mouse over for more information) d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 |