![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
![]() | Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein) membrane-anchored rubredoxin-like domain |
![]() | Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries) |
![]() | Domain d2eins1: 2ein S:1-98 [132271] Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 automatically matched to d1occf_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOP Domain Sequences for d2eins1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eins1 g.41.5.3 (S:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d2eins1:
![]() Domains from other chains: (mouse over for more information) d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 |