Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (23 PDB entries) |
Domain d2einr_: 2ein R: [132270] Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ automated match to d1occe_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOPe Domain Sequences for d2einr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d2einr_:
View in 3D Domains from other chains: (mouse over for more information) d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ |