SCOPe 2.08: Domain d2einr_: 2ein R:

Lineage for d2einr_ (2ein R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)

8. Domain d2einr_: 2ein R: [132270]
   Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_
   automated match to d1occe_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einr_

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (R:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2einr_:

Sequence; same for both SEQRES and ATOM records:

>d2einr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d2einr_:

• d2einr_ first appeared in SCOP 1.73, called d2einr1
  
• d2einr_ appears in SCOPe 2.07