Lineage for d2einp1 (2ein P:3-261)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746159Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 746160Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 746161Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 746174Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 746175Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)
  8. 746199Domain d2einp1: 2ein P:3-261 [132268]
    Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
    automatically matched to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einp1

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2einp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einp1 f.25.1.1 (P:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOP Domain Coordinates for d2einp1:

Click to download the PDB-style file with coordinates for d2einp1.
(The format of our PDB-style files is described here.)

Timeline for d2einp1: