Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries) |
Domain d2einp1: 2ein P:3-261 [132268] Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 automatically matched to d1v54c_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOP Domain Sequences for d2einp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einp1 f.25.1.1 (P:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d2einp1:
View in 3D Domains from other chains: (mouse over for more information) d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 |