Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries) |
Domain d2einn1: 2ein N:1-514 [132265] Other proteins in same PDB: d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 automatically matched to d1occa_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOP Domain Sequences for d2einn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einn1 f.24.1.1 (N:1-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d2einn1:
View in 3D Domains from other chains: (mouse over for more information) d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 |