SCOP 1.73: Domain d2einn1: 2ein N:1-514

Lineage for d2einn1 (2ein N:1-514)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries)

8. Domain d2einn1: 2ein N:1-514 [132265]
   Other proteins in same PDB: d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
   automatically matched to d1occa_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einn1

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOP Domain Sequences for d2einn1:

Sequence; same for both SEQRES and ATOM records:

>d2einn1 f.24.1.1 (N:1-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d2einn1:

• d2einn1 is new in SCOP 1.73
  
• d2einn1 appears in SCOP 1.75
  
• d2einn1 appears in the current release, SCOPe 2.08, called d2einn_