SCOPe 2.06: Domain d2einh_: 2ein H:

Lineage for d2einh_ (2ein H:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein automated matches [190271] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187063] (19 PDB entries)

8. Domain d2einh_: 2ein H: [132259]
   Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_
   automated match to d1ocrh_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einh_

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2einh_:

Sequence; same for both SEQRES and ATOM records:

>d2einh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2einh_:

• d2einh_ first appeared in SCOP 1.73, called d2einh1
  
• d2einh_ appears in SCOPe 2.05
  
• d2einh_ appears in SCOPe 2.07
  
• d2einh_ appears in the current release, SCOPe 2.08